CTRB1 anticorps (Middle Region)

N° du produit ABIN636071

Détail du produit anti-CTRB1 anticorps

Antigène: CTRB1 (Chymotrypsinogen B1 (CTRB1))

Épitope: Middle Region

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CTRB1 est non-conjugé

Application: Western Blotting (WB)

Specificité: Chymotrypsinogen B1 antibody was raised against the middle region of CTRB1

Purification: Affinity purified

Immunogène: Chymotrypsinogen B1 antibody was raised using the middle region of CTRB1 corresponding to a region with amino acids FKNPKFSILTVNNDITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCAT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Chymotrypsinogen B1 Blocking Peptide, catalog no. 33R-2951, is also available for use as a blocking control in assays to test for specificity of this Chymotrypsinogen B1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CTRB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CTRB1

Antigène: CTRB1 (Chymotrypsinogen B1 (CTRB1))

Autre désignation: Chymotrypsinogen B1 (CTRB1 Produits)

Synonymes: anticorps wu:fb61f07, anticorps wu:fb69e12, anticorps CTRB1, anticorps 2200008D09Rik, anticorps AI504462, anticorps Ctrb, anticorps Prt-2, anticorps CTRB, anticorps ctrb, anticorps ctrb2, anticorps chymotrypsinogen B1, anticorps chymotrypsinogen B, anticorps chymostrypsinogen B1-like, anticorps chymotrypsinogen B1 L homeolog, anticorps CTRB1, anticorps ctrb1, anticorps LOC618826, anticorps LOC713851, anticorps LOC479649, anticorps Ctrb1, anticorps ctrb1.L, anticorps LOC102150576

Sujet: Alpha-chymotrypsin (EC 3.4.21.1) is one of a family of serine proteases secreted into the gastrointestinal tract as the inactive precursor chymotrypsinogen. The zymogen is activated by proteolytic cleavage by trypsin.

Poids moléculaire: 28 kDa (MW of target protein)