Parathyroid Hormone 2 (PTH2) (Middle Region) anticorps

N° du produit ABIN636078

Détail du produit

Antigène: Parathyroid Hormone 2 (PTH2)

Épitope: Middle Region

Reactivité: Hormone

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Specificité: PTH2 antibody was raised against the middle region of PTH2

Purification: Affinity purified

Immunogène: PTH2 antibody was raised using the middle region of PTH2 corresponding to a region with amino acids WADPATPRPRRSLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PTH2 Blocking Peptide, catalog no. 33R-9931, is also available for use as a blocking control in assays to test for specificity of this PTH2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTH2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: Parathyroid Hormone 2 (PTH2)

Autre désignation: PTH2 (PTH2 Produits)

Synonymes: anticorps TIP39, anticorps Tifp39, anticorps Tip39, anticorps RGD1559447, anticorps pth2, anticorps parathyroid hormone 2, anticorps parathyroid hormone 1b, anticorps tuberoinfundibular 39 residue protein, anticorps PTH2, anticorps Pth2, anticorps pth1b, anticorps TIP39

Classe de substances: Hormone

Sujet: TIP39 is related to parathyroid hormone (PTH) and PTH-related protein (PTHRP) and is a ligand for PTH receptor-2.

Poids moléculaire: 11 kDa (MW of target protein)

Pathways: Sensory Perception of Sound, cAMP Metabolic Process, Regulation of Muscle Cell Differentiation, Tube Formation, Skeletal Muscle Fiber Development