MAGT1 anticorps (N-Term)
-
- Antigène Voir toutes MAGT1 Anticorps
- MAGT1 (Magnesium Transporter 1 (MAGT1))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MAGT1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RP11-217 H1.1 antibody was raised against the N terminal Of Rp11-217 1.1
- Purification
- Affinity purified
- Immunogène
- RP11-217 H1.1 antibody was raised using the N terminal Of Rp11-217 1.1 corresponding to a region with amino acids ARWRFWCVSVTMVVALLIVCDVPSASAQRKKEMVLSEKVSQLMEWTNKRP
- Top Product
- Discover our top product MAGT1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RP11-217H1.1 Blocking Peptide, catalog no. 33R-1500, is also available for use as a blocking control in assays to test for specificity of this RP11-217H1.1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RP11-210 1.1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MAGT1 (Magnesium Transporter 1 (MAGT1))
- Autre désignation
- RP11-217H1.1 (MAGT1 Produits)
- Synonymes
- anticorps IAP, anticorps MRX95, anticorps OST3B, anticorps PRO0756, anticorps XMEN, anticorps bA217H1.1, anticorps 2410001C15Rik, anticorps 2610529C04Rik, anticorps 2810482I07Rik, anticorps IAG2, anticorps Iag2, anticorps magnesium transporter 1, anticorps MAGT1, anticorps Magt1
- Sujet
- The function of RP11-217H1.1 protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 41 kDa (MW of target protein)
- Pathways
- Cell RedoxHomeostasis
-