MAGT1 anticorps (N-Term)

N° du produit ABIN636081

Détail du produit anti-MAGT1 anticorps

Antigène: MAGT1 (Magnesium Transporter 1 (MAGT1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MAGT1 est non-conjugé

Application: Western Blotting (WB)

Specificité: RP11-217 H1.1 antibody was raised against the N terminal Of Rp11-217 1.1

Purification: Affinity purified

Immunogène: RP11-217 H1.1 antibody was raised using the N terminal Of Rp11-217 1.1 corresponding to a region with amino acids ARWRFWCVSVTMVVALLIVCDVPSASAQRKKEMVLSEKVSQLMEWTNKRP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RP11-217H1.1 Blocking Peptide, catalog no. 33R-1500, is also available for use as a blocking control in assays to test for specificity of this RP11-217H1.1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RP11-210 1.1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MAGT1

Antigène: MAGT1 (Magnesium Transporter 1 (MAGT1))

Autre désignation: RP11-217H1.1 (MAGT1 Produits)

Synonymes: anticorps IAP, anticorps MRX95, anticorps OST3B, anticorps PRO0756, anticorps XMEN, anticorps bA217H1.1, anticorps 2410001C15Rik, anticorps 2610529C04Rik, anticorps 2810482I07Rik, anticorps IAG2, anticorps Iag2, anticorps magnesium transporter 1, anticorps MAGT1, anticorps Magt1

Sujet: The function of RP11-217H1.1 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 41 kDa (MW of target protein)

Pathways: Cell RedoxHomeostasis