NKAIN4 anticorps (Middle Region)
-
- Antigène Voir toutes NKAIN4 Anticorps
- NKAIN4 (Na+/K+ Transporting ATPase Interacting 4 (NKAIN4))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NKAIN4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- NKAIN4 antibody was raised against the middle region of NKAIN4
- Purification
- Affinity purified
- Immunogène
- NKAIN4 antibody was raised using the middle region of NKAIN4 corresponding to a region with amino acids LLGFVCGCQVVSVFTDEEDSFDFIGGFDPFPLYHVNEKPSSLLSKQVYLP
- Top Product
- Discover our top product NKAIN4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NKAIN4 Blocking Peptide, catalog no. 33R-5141, is also available for use as a blocking control in assays to test for specificity of this NKAIN4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NKAIN4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NKAIN4 (Na+/K+ Transporting ATPase Interacting 4 (NKAIN4))
- Autre désignation
- NKAIN4 (NKAIN4 Produits)
- Synonymes
- anticorps zgc:172210, anticorps C20orf58, anticorps FAM77A, anticorps bA261N11.2, anticorps AB030182, anticorps C030019F02Rik, anticorps RGD1305809, anticorps sodium/potassium transporting ATPase interacting 4, anticorps Na+/K+ transporting ATPase interacting 4, anticorps Sodium/potassium transporting ATPase interacting 4, anticorps sodium/potassium-transporting ATPase subunit beta-1-interacting protein 4, anticorps nkain4, anticorps NKAIN4, anticorps Nkain4
- Sujet
- The specific function of NKAIN4 is not yet known.
- Poids moléculaire
- 23 kDa (MW of target protein)
-