STS anticorps

N° du produit ABIN636085

Détail du produit anti-STS anticorps

Antigène: STS (Steroid Sulfatase (Microsomal), Isozyme S (STS))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp STS est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: STS antibody was raised using a synthetic peptide corresponding to a region with amino acids EPTSNMDIFPTVAKLAGAPLPEDRIIDGRDLMPLLEGKSQRSDHEFLFHY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

STS Blocking Peptide, catalog no. 33R-2652, is also available for use as a blocking control in assays to test for specificity of this STS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur STS

Antigène: STS (Steroid Sulfatase (Microsomal), Isozyme S (STS))

Autre désignation: STS (STS Produits)

Synonymes: anticorps ARSC, anticorps ARSC1, anticorps ASC, anticorps ES, anticorps SSDD, anticorps XLI, anticorps abcg2, anticorps ArsC, anticorps Sts, anticorps si:ch211-271l9.1, anticorps steroid sulfatase, anticorps breast cancer resistance protein, anticorps Steryl-sulfatase, anticorps steryl-sulfatase, anticorps steroid sulfatase (microsomal), isozyme S, anticorps STS, anticorps abcg2, anticorps Sts, anticorps Plav_0360, anticorps Psta_3963, anticorps Runsl_5106, anticorps LOC100712701, anticorps sts

Sujet: STS catalyzes the conversion of sulfated steroid precursors to estrogens during pregnancy. The protein is found in the endoplasmic reticulum, where it acts as a homodimer. Mutations in its gene are known to cause X-linked ichthyosis.

Poids moléculaire: 63 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis