IL13RA2 anticorps (Middle Region)
-
- Antigène Voir toutes IL13RA2 Anticorps
- IL13RA2 (Interleukin 13 Receptor, alpha 2 (IL13RA2))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp IL13RA2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- IL13 RA2 antibody was raised against the middle region of IL13 A2
- Purification
- Affinity purified
- Immunogène
- IL13 RA2 antibody was raised using the middle region of IL13 A2 corresponding to a region with amino acids GQNIGCRFPYLEASDYKDFYICVNGSSENKPIRSSYFTFQLQNIVKPLPP
- Top Product
- Discover our top product IL13RA2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
IL13RA2 Blocking Peptide, catalog no. 33R-3505, is also available for use as a blocking control in assays to test for specificity of this IL13RA2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL10 A2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- IL13RA2 (Interleukin 13 Receptor, alpha 2 (IL13RA2))
- Autre désignation
- IL13RA2 (IL13RA2 Produits)
- Synonymes
- anticorps il-13ra2, anticorps sb:cb602, anticorps si:dkeyp-110c7.6, anticorps CD213A2, anticorps CT19, anticorps IL-13R, anticorps IL13BP, anticorps CD213a2, anticorps IL-13R-alpha-2, anticorps IL13RA2, anticorps interleukin 13 receptor, alpha 2, anticorps interleukin 13 receptor subunit alpha 2, anticorps interleukin 13 receptor subunit alpha 2 S homeolog, anticorps il13ra2, anticorps IL13RA2, anticorps il13ra2.S, anticorps Il13ra2
- Sujet
- IL13RA2 is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. IL13RA2 binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13.
- Poids moléculaire
- 42 kDa (MW of target protein)
-