LRRC33 anticorps (N-Term)

N° du produit ABIN636092

Détail du produit anti-LRRC33 anticorps

Antigène: LRRC33 (NRROS) (Negative Regulator of Reactive Oxygen Species (NRROS))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LRRC33 est non-conjugé

Application: Western Blotting (WB)

Specificité: LRRC33 antibody was raised against the N terminal of LRRC33

Purification: Affinity purified

Immunogène: LRRC33 antibody was raised using the N terminal of LRRC33 corresponding to a region with amino acids GLERLRELDLQRNYIFEIEGGAFDGLAELRHLNLAFNNLPCIVDFGLTRL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LRRC33 Blocking Peptide, catalog no. 33R-3389, is also available for use as a blocking control in assays to test for specificity of this LRRC33 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC33 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LRRC33

Antigène: LRRC33 (NRROS) (Negative Regulator of Reactive Oxygen Species (NRROS))

Autre désignation: LRRC33 (NRROS Produits)

Synonymes: anticorps GARPL1, anticorps LRRC33, anticorps UNQ3030, anticorps negative regulator of reactive oxygen species, anticorps NRROS

Sujet: The function of LRRC33 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 76 kDa (MW of target protein)