Klotho anticorps (Middle Region)
-
- Antigène Voir toutes Klotho (KL) Anticorps
- Klotho (KL)
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Klotho est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Klotho antibody was raised against the middle region of KL
- Purification
- Affinity purified
- Immunogène
- Klotho antibody was raised using the middle region of KL corresponding to a region with amino acids HRGYSIRRGLFYVDFLSQDKMLLPKSSALFYQKLIEKNGFPPLPENQPLE
- Top Product
- Discover our top product KL Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Klotho Blocking Peptide, catalog no. 33R-3841, is also available for use as a blocking control in assays to test for specificity of this Klotho antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KL antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Klotho (KL)
- Autre désignation
- Klotho (KL Produits)
- Synonymes
- anticorps alpha-kl, anticorps KL, anticorps LOC100223456, anticorps klotho, anticorps Klotho, anticorps KL, anticorps Kl, anticorps kl, anticorps LOC100533542
- Sujet
- This gene encodes a type-I membrane protein that is related to beta-glucosidases. Reduced production of this protein has been observed in patients with chronic renal failure (CRF), and this may be one of the factors underlying the degenerative processes.
- Poids moléculaire
- 116 kDa (MW of target protein)
- Pathways
- Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Hormone Activity, Growth Factor Binding
-