IZUMO1 anticorps (C-Term)

N° du produit ABIN636096

Détail du produit anti-IZUMO1 anticorps

Antigène: IZUMO1 (Izumo Sperm-Egg Fusion 1 (IZUMO1))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IZUMO1 est non-conjugé

Application: Western Blotting (WB)

Specificité: IZUMO1 antibody was raised against the C terminal of IZUMO1

Purification: Affinity purified

Immunogène: IZUMO1 antibody was raised using the C terminal of IZUMO1 corresponding to a region with amino acids SLALITGLTFAIFRRRKVIDFIKSSLFGLGSGAAEQTQVPKEKATDSRQQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IZUMO1 Blocking Peptide, catalog no. 33R-8575, is also available for use as a blocking control in assays to test for specificity of this IZUMO1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IZUMO1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IZUMO1

Antigène: IZUMO1 (Izumo Sperm-Egg Fusion 1 (IZUMO1))

Autre désignation: IZUMO1 (IZUMO1 Produits)

Synonymes: anticorps IZUMO, anticorps 1700058F15Rik, anticorps Izumo, anticorps izumo sperm-egg fusion 1, anticorps Ras interacting protein 1, anticorps IZUMO1, anticorps RASIP1, anticorps Izumo1

Sujet: The sperm-specific protein Izumo, named for a Japanese shrine dedicated to marriage, is essential for sperm-egg plasma membrane binding and fusion.

Poids moléculaire: 39 kDa (MW of target protein)