Collagen, Type XXVI, alpha 1 (COL26A1) (C-Term) anticorps
-
- Antigène Voir toutes Collagen, Type XXVI, alpha 1 (COL26A1) Anticorps
- Collagen, Type XXVI, alpha 1 (COL26A1)
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Inconjugué
-
Application
- Western Blotting (WB)
- Specificité
- EMID2 antibody was raised against the C terminal of EMID2
- Purification
- Affinity purified
- Immunogène
- EMID2 antibody was raised using the C terminal of EMID2 corresponding to a region with amino acids GVQQLREALKILAERVLILEHMIGIHDPLASPEGGSGQDAALRANLKMKR
- Top Product
- Discover our top product COL26A1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
EMID2 Blocking Peptide, catalog no. 33R-3653, is also available for use as a blocking control in assays to test for specificity of this EMID2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EMID2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Collagen, Type XXVI, alpha 1 (COL26A1)
- Autre désignation
- EMID2 (COL26A1 Produits)
- Synonymes
- anticorps EMID2, anticorps EMI6, anticorps EMU2, anticorps Emu2, anticorps SH2B, anticorps 9430032K24Rik, anticorps BC002218, anticorps Col26a, anticorps Emid2, anticorps collagen type XXVI alpha 1 chain, anticorps collagen, type XXVI, alpha 1, anticorps COL26A1, anticorps Col26a1
- Sujet
- EMID2 contains 1 EMI domain and 2 collagen-like domains. The exact function of ZCCHC3 remains unknown.
- Poids moléculaire
- 45 kDa (MW of target protein)
-