SLC19A3 anticorps (Middle Region)
-
- Antigène Voir toutes SLC19A3 (Slc19a3) Anticorps
- SLC19A3 (Slc19a3) (Solute Carrier Family 19, Member 3 (Slc19a3))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC19A3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SLC19 A3 antibody was raised against the middle region of SLC19 3
- Purification
- Affinity purified
- Immunogène
- SLC19 A3 antibody was raised using the middle region of SLC19 3 corresponding to a region with amino acids FATAGFNQVLNYVQILWDYKAPSQDSSIYNGAVEAIATFGGAVAAFAVGY
- Top Product
- Discover our top product Slc19a3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC19A3 Blocking Peptide, catalog no. 33R-2848, is also available for use as a blocking control in assays to test for specificity of this SLC19A3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC19A3 (Slc19a3) (Solute Carrier Family 19, Member 3 (Slc19a3))
- Autre désignation
- SLC19A3 (Slc19a3 Produits)
- Synonymes
- anticorps BBGD, anticorps THMD2, anticorps THTR2, anticorps thtr2, anticorps MGC52872, anticorps MGC89434, anticorps si:dkey-223n17.4, anticorps slc19a3, anticorps A230084E24Rik, anticorps AI788884, anticorps ThTr2, anticorps solute carrier family 19 member 3, anticorps solute carrier family 19 member 3 L homeolog, anticorps solute carrier family 19 (thiamine transporter), member 3, anticorps thiamine transporter 2, anticorps solute carrier family 19 (thiamine transporter), member 3b, anticorps solute carrier family 19, member 3, anticorps thiamine transporter 2-like, anticorps SLC19A3, anticorps Slc19a3, anticorps slc19a3.L, anticorps slc19a3, anticorps LOC486151, anticorps slc19a3b, anticorps LOC100230080
- Sujet
- SLC19A3 mediates high affinity thiamine uptake, propably via a proton anti-port mechanism. SLC19A3 has no folate transport activity.SLC19A3 is a member of the reduced folate family of micronutrient transporter genes.
- Poids moléculaire
- 56 kDa (MW of target protein)
- Pathways
- Dicarboxylic Acid Transport
-