ZPLD1 anticorps (C-Term)

N° du produit ABIN636115

Détail du produit anti-ZPLD1 anticorps

Antigène: ZPLD1 (Zona Pellucida-Like Domain Containing 1 (ZPLD1))

Épitope: C-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ZPLD1 est non-conjugé

Application: Western Blotting (WB)

Specificité: ZPLD1 antibody was raised against the C terminal of ZPLD1

Purification: Affinity purified

Immunogène: ZPLD1 antibody was raised using the C terminal of ZPLD1 corresponding to a region with amino acids DAGRRTTWSPQSSSGSAVLSAGPIITRSDETPTNNSQLGSPSMPPFQLNA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ZPLD1 Blocking Peptide, catalog no. 33R-1851, is also available for use as a blocking control in assays to test for specificity of this ZPLD1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZPLD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ZPLD1

Antigène: ZPLD1 (Zona Pellucida-Like Domain Containing 1 (ZPLD1))

Autre désignation: ZPLD1 (ZPLD1 Produits)

Synonymes: anticorps 9430016A21Rik, anticorps zona pellucida like domain containing 1, anticorps si:ch211-229d2.5, anticorps zona pellucida-like domain containing 1 S homeolog, anticorps ZPLD1, anticorps si:ch211-229d2.5, anticorps zpld1, anticorps Zpld1, anticorps zpld1.S

Sujet: The function of ZPLD1 has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 47 kDa (MW of target protein)