UGT1A6 anticorps (C-Term)

N° du produit ABIN636119

Détail du produit anti-UGT1A6 anticorps

Antigène: UGT1A6 (UDP Glucuronosyltransferase 1 Family, Polypeptide A6 (UGT1A6))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UGT1A6 est non-conjugé

Application: Western Blotting (WB)

Specificité: UGT1 A6 antibody was raised against the C terminal of µgT1 6

Purification: Affinity purified

Immunogène: UGT1 A6 antibody was raised using the C terminal of µgT1 6 corresponding to a region with amino acids APHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UGT1A6 Blocking Peptide, catalog no. 33R-1424, is also available for use as a blocking control in assays to test for specificity of this µgT1A6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgT0 6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UGT1A6

Antigène: UGT1A6 (UDP Glucuronosyltransferase 1 Family, Polypeptide A6 (UGT1A6))

Autre désignation: UGT1A6 (UGT1A6 Produits)

Synonymes: anticorps GNT1, anticorps HLUGP, anticorps HLUGP1, anticorps UDPGT, anticorps UDPGT 1-6, anticorps UGT1, anticorps UGT1A6S, anticorps UGT1F, anticorps UGT1A10, anticorps UGT1A6, anticorps UGT1A7, anticorps UGT1A8, anticorps UGT1A9, anticorps DKFZP469F071, anticorps UGT1A5, anticorps UGT, anticorps Udpgt, anticorps Ugt1, anticorps Ugt1a7, anticorps UGT1-06, anticorps UGT1.6, anticorps Ugt1a6b, anticorps Ugt1a6, anticorps UDP glucuronosyltransferase family 1 member A6, anticorps UDP glucuronosyltransferase family 1 member A1, anticorps UDP glucuronosyltransferase 1 family, polypeptide A6, anticorps UDP-glucuronosyltransferase 1-1, anticorps UDP glucuronosyltransferase 1 family, polypeptide A6 S homeolog, anticorps UDP-glucuronosyltransferase 1-6, anticorps UGT1A6, anticorps UGT1A1, anticorps LOC739942, anticorps ugt1a6.S, anticorps ugt1a6, anticorps LOC100481084, anticorps Ugt1a6, anticorps UGT1-6, anticorps LOC100731122

Sujet: UGT1A6 is a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases.

Poids moléculaire: 58 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis, Regulation of Lipid Metabolism by PPARalpha