EDAR anticorps (Middle Region)

N° du produit ABIN636121

Détail du produit anti-EDAR anticorps

Antigène: EDAR (Ectodysplasin A Receptor (EDAR))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EDAR est non-conjugé

Application: Western Blotting (WB)

Specificité: Ectodysplasin A Receptor antibody was raised against the middle region of EDAR

Purification: Affinity purified

Immunogène: Ectodysplasin A Receptor antibody was raised using the middle region of EDAR corresponding to a region with amino acids PAPDKQGSPELCLLSLVHLAREKSATSNKSAGIQSRRKKILDVYANVCGV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Ectodysplasin A Receptor Blocking Peptide, catalog no. 33R-6971, is also available for use as a blocking control in assays to test for specificity of this Ectodysplasin A Receptor antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EDAR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EDAR

Antigène: EDAR (Ectodysplasin A Receptor (EDAR))

Autre désignation: Ectodysplasin A Receptor (EDAR Produits)

Synonymes: anticorps rs3, anticorps edar, anticorps EDAR, anticorps MGC88893, anticorps DL, anticorps ECTD10A, anticorps ECTD10B, anticorps ED1R, anticorps ED3, anticorps ED5, anticorps EDA-A1R, anticorps EDA1R, anticorps EDA3, anticorps HRM1, anticorps dl, anticorps RGD1561714, anticorps ectodysplasin A receptor, anticorps ectodysplasin-A receptor, anticorps edar, anticorps EDAR, anticorps Edar

Sujet: EDAR is a member of the tumor necrosis factor receptor family. It is a receptor for the soluble ligand ectodysplasin A, and can activate the nuclear factor-kappaB, JNK, and caspase-independent cell death pathways. It is required for the development of hair, teeth, and other ectodermal derivatives. Mutations in the gene encoding EDAR result in autosomal dominant and recessive forms of hypohidrotic ectodermal dysplasia.

Poids moléculaire: 48 kDa (MW of target protein)

Pathways: Tube Formation, Ubiquitin Proteasome Pathway