Sucrase Isomaltase anticorps

N° du produit ABIN6654192

Détail du produit anti-Sucrase Isomaltase anticorps

Antigène: Sucrase Isomaltase (SI) (Sucrase-Isomaltase (Alpha-Glucosidase) (SI))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Sucrase Isomaltase est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogène: Amino acids FQLSRWNYKSLDVVKEVVRRNREAGIPFDTQVTDID were used as the immunogen for the Sucrase Isomaltase antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the Sucrase Isomaltase antibody should be determined by the researcher.\. Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the Sucrase Isomaltase antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur Sucrase Isomaltase

Antigène: Sucrase Isomaltase (SI) (Sucrase-Isomaltase (Alpha-Glucosidase) (SI))

Autre désignation: SI / Sucrase Isomaltase (SI Produits)

Synonymes: anticorps 2010204N08Rik, anticorps SI, anticorps Si-s, anticorps SUCIMAL, anticorps sucrase-isomaltase, intestinal, anticorps sucrase isomaltase (alpha-glucosidase), anticorps sucrase-isomaltase, anticorps Tsp_13316, anticorps Tsp_01057, anticorps Sis, anticorps SI, anticorps Si

Sujet: This gene is mapped to 3q26.1. It encodes a sucrase-isomaltase enzyme that is expressed in the intestinal brush border. The encoded protein is synthesized as a precursor protein that is cleaved by pancreatic proteases into two enzymatic subunits sucrase and isomaltase. These two subunits heterodimerize to form the sucrose-isomaltase complex. This complex is essential for the digestion of dietary carbohydrates including starch, sucrose and isomaltose. Mutations in this gene are the cause of congenital sucrase-isomaltase deficiency.

UniProt: P14410