SLC34A2 anticorps

N° du produit ABIN6719419

Détail du produit anti-SLC34A2 anticorps

Antigène: SLC34A2 (Solute Carrier Family 34 (Sodium Phosphate), Member 2 (SLC34A2))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC34A2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Frozen Sections) (IHC (fro)), Immunocytochemistry (ICC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)

Fonction: Rabbit IgG polyclonal antibody for SLC34A2 detection. Tested with WB, IHC-P, IHC-F, ICC, FCM in Human,Mouse,Rat.

Séquence: QNWTMKNVTY KENIAKCQHI FVNFHLPDLA

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for SLC34A2 detection. Tested with WB, IHC-P, IHC-F, ICC, FCM in Human,Mouse,Rat.

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence of human SLC34A2 (QNWTMKNVTYKENIAKCQHIFVNFHLPDLA).

Isotype: IgG

Information d'application

Indications d'application:

Application details: Western blot|0.1-0.5 μg/mL Immunohistochemistry(Paraffin-embedded Section)|0.5-1 μg/mL Immunohistochemistry(Frozen Section)|0.5-1 μg/mL Immunocytochemistry|0.5-1 μg/mL Flow Cytometry|1-3 μg/1x106 cells

Commentaires:

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur SLC34A2

Antigène: SLC34A2 (Solute Carrier Family 34 (Sodium Phosphate), Member 2 (SLC34A2))

Autre désignation: SLC34A2 (SLC34A2 Produits)

Synonymes: anticorps SLC34A2, anticorps AA536683, anticorps D5Ertd227e, anticorps NaPi-2b, anticorps Npt2b, anticorps NAPI-3B, anticorps NAPI-IIb, anticorps NPTIIb, anticorps solute carrier family 34 member 2, anticorps solute carrier family 34 (sodium phosphate), member 2, anticorps SLC34A2, anticorps Slc34a2

Sujet:

Synonyms: Sodium-dependent phosphate transport protein 2B, Sodium-phosphate transport protein 2B, Na(+)-dependent phosphate cotransporter 2B, NaPi3b, Sodium/phosphate cotransporter 2B, Na(+)/Pi cotransporter 2B, NaPi-2b, Solute carrier family 34 member 2, SLC34A2

Background: Sodium-dependent phosphate transport protein 2B (NaPi2b) is a protein that in humans is encoded by the SLC34A2 gene. The protein encoded by this gene is a pH -sensitive sodium-dependent phosphate transporter. Phosphate uptake is increased at lower pH . Defects in this gene are a cause of pulmonary alveolar microlithiasis. Three transcript variants encoding two different isoforms have been found for this gene.

ID gène: 10568

UniProt: O95436