HAS1 anticorps
-
- Antigène Voir toutes HAS1 Anticorps
- HAS1 (Hyaluronan Synthase 1 (HAS1))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp HAS1 est non-conjugé
-
Application
- Western Blotting (WB), Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Fonction
- Rabbit IgG polyclonal antibody for Hyaluronan synthase 1/HAS1 detection. Tested with WB, IHC-P, ICC/IF in Human,Mouse,Rat.
- Séquence
- NRAEDLYMVD MFREVFADED PATYVWDGNY HQPWEPA
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
- Rabbit IgG polyclonal antibody for Hyaluronan synthase 1/HAS1 detection. Tested with WB, IHC-P, ICC/IF in Human,Mouse,Rat.
- Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence of human Hyaluronan synthase 1/HAS1(NRAEDLYMVDMFREVFADEDPATYVWDGNYHQPWEPA)
- Isotype
- IgG
- Top Product
- Discover our top product HAS1 Anticorps primaire
-
-
- Indications d'application
-
Application details: Western blot|0.1-0.5 μg/mL Immunohistochemistry(Paraffin-embedded Section)|0.5-1 μg/mL Immunocytochemistry/Immunofluorescence|2 μg/mL
- Commentaires
-
Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Stock
- 4 °C,-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- HAS1 (Hyaluronan Synthase 1 (HAS1))
- Autre désignation
- HAS1 (HAS1 Produits)
- Synonymes
- anticorps dg42, anticorps Xhas1, anticorps HAS, anticorps shas1, anticorps hyaluronan synthase 1, anticorps hyaluronan synthase 1 S homeolog, anticorps has1, anticorps HAS1, anticorps Has1, anticorps has1.S
- Sujet
-
Synonyms: Hyaluronan synthase 1, Hyaluronate synthase 1, Hyaluronic acid synthase 1, HA synthase 1, HuHAS1, HAS1, HAS
Background: Hyaluronan synthase 1 is an enzyme that in humans is encoded by the HAS1 gene. This gene is mapped to 19q13.41. Hyaluronan or hyaluronic acid (HA) is a high molecular weight unbranched polysaccharide synthesized by a wide variety of organisms from bacteria to mammals, and is a constituent of the extracellular matrix. It consists of alternating glucuronic acid and N-acetylglucosamine residues that are linked by beta-1-3 and beta-1-4 glycosidic bonds. It serves a variety of functions, including space filling, lubrication of joints, and provision of a matrix through which cells can migrate. HA is actively produced during wound healing and tissue repair to provide a framework for ingrowth of blood vessels and fibroblasts. AS1 is a member of the newly identified vertebrate gene family encoding putative hyaluronan synthases, and its amino acid sequence shows significant homology to the hasA gene product of Streptococcus pyogenes, a glycosaminoglycan synthetase (DG42) from Xenopus laevis, and a recently described murine hyaluronan synthase.
- ID gène
- 3036
- UniProt
- Q92839
- Pathways
- Glycosaminoglycan Metabolic Process
-