HECTD3 anticorps
-
- Antigène Voir toutes HECTD3 Anticorps
- HECTD3 (HECT Domain Containing 3 (HECTD3))
- Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp HECTD3 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (Frozen Sections) (IHC (fro)), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunocytochemistry (ICC), Flow Cytometry (FACS)
- Fonction
- Rabbit IgG polyclonal antibody for HECTD3 detection. Tested with WB, IHC-P, IHC-F, ICC, FCM in Human,Mouse,Rat.
- Séquence
- HYASAKVCEE KLRYAAYNCV AIDTDMSPWE E
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
- Rabbit IgG polyclonal antibody for HECTD3 detection. Tested with WB, IHC-P, IHC-F, ICC, FCM in Human,Mouse,Rat.
- Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence of human HECTD3(HYASAKVCEEKLRYAAYNCVAIDTDMSPWEE).
- Isotype
- IgG
- Top Product
- Discover our top product HECTD3 Anticorps primaire
-
-
- Indications d'application
-
Application details: Western blot|0.1-0.5 μg/mL Immunohistochemistry(Paraffin-embedded Section)|0.5-1 μg/mL Immunohistochemistry(Frozen Section)|0.5-1 μg/mL Immunocytochemistry|0.5-1 μg/mL Flow Cytometry|1-3 μg/1x106 cells
- Commentaires
-
Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Stock
- 4 °C,-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- HECTD3 (HECT Domain Containing 3 (HECTD3))
- Autre désignation
- HECTD3 (HECTD3 Produits)
- Synonymes
- anticorps 1700064K09Rik, anticorps AI467540, anticorps AW743312, anticorps RP11-69J16.1, anticorps E3 ubiquitin-protein ligase HECTD3-like, anticorps HECT domain E3 ubiquitin protein ligase 3, anticorps LOC100222219, anticorps HECTD3, anticorps Hectd3
- Sujet
-
Synonyms: E3 ubiquitin-protein ligase HECTD3, HECT domain-containing protein 3, HECT-type E3 ubiquitin transferase HECTD3, HECTD3
Background: The protein encoded by this gene transfers ubiquitin from an E2 ubiquitin-conjugating enzyme to targeted substrates, leading to the degradation of those substrates. This gene is mapped to 1p34.1. The encoded protein has been shown to transfer ubiquitin to TRIOBP to facilitate cell cycle progression, and to STX8.
- ID gène
- 79654
- UniProt
- Q5T447
-