MAP3K1 anticorps (AA 1077-1176)
-
- Antigène Voir toutes MAP3K1 Anticorps
- MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1 (MAP3K1))
-
Épitope
- AA 1077-1176
-
Reactivité
- Humain
-
Hôte
- Souris
-
Clonalité
- Monoclonal
-
Conjugué
- Cet anticorp MAP3K1 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC), Staining Methods (StM)
- Purification
- Purified by Protein A/G
- Immunogène
- Partial recombinant MAP3K1 (aa1077-1176) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK)
- Clone
- 2F6
- Isotype
- IgG2a kappa
- Top Product
- Discover our top product MAP3K1 Anticorps primaire
-
-
- Indications d'application
-
Positive Control: A431, HeLa or HL-60 cells. Liver tissue.
Known Application: Western Blot (0.5-1 μg/mL),Immunohistochemistry (Formalin-fixed) (1-2 μg/mL for 30 minutes at RT)(Staining of formalin-fixed tissues requires boiling tissue sections in 10 mM Tris Buffer with 1 mM EDTA, pH 9.0, for 10-20 min followed by cooling at RT for 20 minutes)Optimal dilution for a specific application should be determined.
- Restrictions
- For Research Use only
-
- Concentration
- 200 μg/mL
- Buffer
- 10 mM PBS with 0.05 % BSA & 0.05 % azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Stock
- 4 °C,-80 °C
- Stockage commentaire
- Antibody with azide - store at 2 to 8°C. Antibody without azide - store at -20 to -80°C. Antibody is stable for 24 months. Non-hazardous. No MSDS required.
- Date de péremption
- 24 months
-
- Antigène
- MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1 (MAP3K1))
- Autre désignation
- MAP3K1 (MAP3K1 Produits)
- Synonymes
- anticorps MAP3K1, anticorps Mekk1, anticorps MAPKKK1, anticorps MEKK1, anticorps Mekk, anticorps ARAKIN, anticorps ATMEKK1, anticorps MAPK/ERK kinase kinase 1, anticorps MAPKKK8, anticorps T15F16.5, anticorps T15F16_5, anticorps MEKK, anticorps MEKK 1, anticorps SRXY6, anticorps mitogen-activated protein kinase kinase kinase 1, anticorps mitogen-activated protein kinase kinase kinase 1, E3 ubiquitin protein ligase, anticorps MAPK/ERK kinase kinase 1, anticorps MAP3K1, anticorps map3k1, anticorps Map3k1, anticorps MEKK1
- Sujet
- Mitogen-activated protein (MAP) kinase cascades are activated by various extracellular stimuli, including growth factors. The MEK kinases (also designated MAP kinase kinase kinases, MKKKs, MAP3Ks or MEKKs) phosphorylate and thereby activate the MEKs (also called MAP kinase kinases or MKKs), including ERK, JNK and p38. These activated MEKs in turn phosphorylate and activate the MAP kinases. The MEK kinases include Raf-1, Raf-B, Mos, MEK kinase-1, MEK kinase-2, MEK kinase-3, MEK kinase-4 and ASK 1 (MEK kinase- 5). MEK kinase-1 activates the ERK and c-Jun NH2-terminal kinase (JNK) pathways by phosphorylation of MAP2K1 and MAP2K4, and also activates the central protein kinases of the NFB pathway, CHUK and IKBKB. Additionally, MEK kinase-1 uses an E3 ligase through its PHD domain, a RING-finger-like structure, to target proteins for degradation through ubiquitination.
- Poids moléculaire
- 195kDa (intact), 80kDa (cleaved)
- ID gène
- 4214
- UniProt
- Q13233
- Pathways
- Signalisation MAPK, Interferon-gamma Pathway, Caspase Cascade in Apoptosis, Signalisation TLR, Fc-epsilon Receptor Signaling Pathway, Activation of Innate immune Response, Regulation of Actin Filament Polymerization, Toll-Like Receptors Cascades
-