MAP3K1 anticorps (AA 1077-1176)

N° du produit ABIN6940032

Détail du produit anti-MAP3K1 anticorps

Antigène: MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1 (MAP3K1))

Épitope: AA 1077-1176

Reactivité: Humain

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp MAP3K1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC), Staining Methods (StM)

Purification: Purified by Protein A/G

Immunogène: Partial recombinant MAP3K1 (aa1077-1176) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK)

Clone: 2F6

Isotype: IgG2a kappa

Information d'application

Indications d'application:

Positive Control: A431, HeLa or HL-60 cells. Liver tissue.

Known Application: Western Blot (0.5-1 μg/mL),Immunohistochemistry (Formalin-fixed) (1-2 μg/mL for 30 minutes at RT)(Staining of formalin-fixed tissues requires boiling tissue sections in 10 mM Tris Buffer with 1 mM EDTA, pH 9.0, for 10-20 min followed by cooling at RT for 20 minutes)Optimal dilution for a specific application should be determined.

Restrictions: For Research Use only

Stockage

Concentration: 200 μg/mL

Buffer: 10 mM PBS with 0.05 % BSA & 0.05 % azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-80 °C

Stockage commentaire: Antibody with azide - store at 2 to 8°C. Antibody without azide - store at -20 to -80°C. Antibody is stable for 24 months. Non-hazardous. No MSDS required.

Date de péremption: 24 months

Détails sur MAP3K1

Antigène: MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1 (MAP3K1))

Autre désignation: MAP3K1 (MAP3K1 Produits)

Sujet: Mitogen-activated protein (MAP) kinase cascades are activated by various extracellular stimuli, including growth factors. The MEK kinases (also designated MAP kinase kinase kinases, MKKKs, MAP3Ks or MEKKs) phosphorylate and thereby activate the MEKs (also called MAP kinase kinases or MKKs), including ERK, JNK and p38. These activated MEKs in turn phosphorylate and activate the MAP kinases. The MEK kinases include Raf-1, Raf-B, Mos, MEK kinase-1, MEK kinase-2, MEK kinase-3, MEK kinase-4 and ASK 1 (MEK kinase- 5). MEK kinase-1 activates the ERK and c-Jun NH2-terminal kinase (JNK) pathways by phosphorylation of MAP2K1 and MAP2K4, and also activates the central protein kinases of the NFB pathway, CHUK and IKBKB. Additionally, MEK kinase-1 uses an E3 ligase through its PHD domain, a RING-finger-like structure, to target proteins for degradation through ubiquitination.

Poids moléculaire: 195kDa (intact), 80kDa (cleaved)

ID gène: 4214

UniProt: Q13233

Pathways: Signalisation MAPK, Interferon-gamma Pathway, Caspase Cascade in Apoptosis, Signalisation TLR, Fc-epsilon Receptor Signaling Pathway, Activation of Innate immune Response, Regulation of Actin Filament Polymerization, Toll-Like Receptors Cascades