ENO2/NSE anticorps (AA 2-285)

N° du produit ABIN7427918

Détail du produit anti-ENO2/NSE anticorps

Antigène: ENO2/NSE (ENO2) (Enolase 2 (Gamma, Neuronal) (ENO2))

Épitope: AA 2-285

Reactivité: Humain

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp ENO2/NSE est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP), Immunocytochemistry (ICC)

Fonction: Monoclonal Antibody to Enolase, Neuron Specific (NSE)

Specificité: The antibody is a mouse monoclonal antibody raised against NSE. It has been selected for its ability to recognize NSE in immunohistochemical staining and western blotting.

Réactivité croisée: Souris, Rat

Purification: Protein A + Protein G affinity chromatography

Immunogène: Recombinant Enolase, Neuron Specific (NSE) corresdonding to Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT with N-terminal His Tag

Clone: C3

Isotype: IgG2b kappa

Information d'application

Indications d'application:

Western blotting: 0.5-2 μg/mL

1:500-2000 Immunohistochemistry: 5-20 μg/mL

1:50-200 Immunocytochemistry: 5-20 μg/mL

1:50-200 Optimal working dilutions must be determined by end user.

Commentaires:

The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.

Restrictions: For Research Use only

Stockage

Format: Liquid

Buffer: PBS, pH 7.4, containing 0.02 % Sodium azide, 50 % glycerol.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: Store at 4°C for frequent use. Stored at -20°C in a manual defrost freezer for two year without detectable loss of activity. Avoid repeated freeze-thaw cycles.

Date de péremption: 24 months

Détails sur ENO2/NSE

Antigène: ENO2/NSE (ENO2) (Enolase 2 (Gamma, Neuronal) (ENO2))

Autre désignation: Enolase, Neuron Specific (ENO2 Produits)

Synonymes: anticorps ENO2, anticorps DKFZp459B1817, anticorps NSE, anticorps AI837106, anticorps D6Ertd375e, anticorps Eno-2, anticorps RNEN3, anticorps eno3, anticorps wu:fc09h05, anticorps zgc:92418, anticorps enolase 2, anticorps enolase 2 (gamma, neuronal), anticorps enolase 2, gamma neuronal, anticorps enolase 2, gamma, neuronal, anticorps ENO2, anticorps Eno2, anticorps eno2

Sujet: ENO2, Enolase 2, Gamma Enolase, 2-phospho-D-glycerate hydro-lyase, Neural enolase