CLCN3 anticorps (C-Term, Intracellular)
-
- Antigène Voir toutes CLCN3 Anticorps
- CLCN3 (Chloride Channel 3 (CLCN3))
-
Épitope
- AA 592-661, C-Term, Intracellular
-
Reactivité
- Rat, Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CLCN3 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC), Immunocytochemistry (ICC), Immunofluorescence (IF), Immunoprecipitation (IP)
- Attributs du produit
- Anti-CLC-3 (CLCN3) Antibody (ABIN7043052, ABIN7044121 and ABIN7044122)) is a highly specific antibody directed against an epitope of the rat protein. The antibody can be used in western blot and immunohistochemistry applications. It has been designed to recognize CLC-3 from rat, mouse, and human samples.
- Purification
- The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.
- Immunogène
-
Immunogen: GST fusion protein
Immunogen Sequence: GST fusion protein with the sequence SLVVIVFELTGGLEYIVPLMAAVMTSKWVGDAFGREGIYEAHIRLNGYPFLDAKEEFTHTTLAADVMRPR, corresponding to amino acid residues 592-661 of rat CLC-3
- Isotype
- IgG
- Top Product
- Discover our top product CLCN3 Anticorps primaire
-
-
- Indications d'application
- Optimal working dilution should be determined by the investigator.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- 25 μL, 50 μL or 0.2 mL double distilled water (DDW), depending on the sample size.
- Concentration
- 0.8 mg/mL
- Buffer
- Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4, 1 % BSA, 5 % sucrose, 0.025 % Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Stock
- RT,4 °C,-20 °C
- Stockage commentaire
-
Storage before reconstitution: The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C.
Storage after reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).
-
- Antigène
- CLCN3 (Chloride Channel 3 (CLCN3))
- Autre désignation
- CLC-3 (CLCN3) (CLCN3 Produits)
- Synonymes
- anticorps CLC3, anticorps ClC-3, anticorps Clc3, anticorps CLCN3, anticorps fb78c02, anticorps wu:fb78c02, anticorps clc3, anticorps clc-3, anticorps chloride voltage-gated channel 3, anticorps chloride channel, voltage-sensitive 3, anticorps chloride channel 3, anticorps chloride channel protein 3, anticorps chloride channel, voltage-sensitive 3 S homeolog, anticorps CLCN3, anticorps Clcn3, anticorps clcn3, anticorps PTRG_03131, anticorps BDBG_05668, anticorps MCYG_04420, anticorps clcn3.S
- Sujet
- Alternative names: CLC-3 (CLCN3), Chloride channel 3, Chloride transporter ClC-3, H+/Cl- exchange transporter 3
- ID gène
- 84360
- NCBI Accession
- NM_001243372
- UniProt
- P51792
-