Peptide YY anticorps
-
- Antigène Voir toutes Peptide YY (PYY) Anticorps
- Peptide YY (PYY)
-
Reactivité
- Différentes espèces
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Peptide YY est non-conjugé
-
Application
- Immunohistochemistry (IHC), Western Blotting (WB)
- Specificité
- Recognizes PYY in a wide range of species.
- Attributs du produit
- Peptide YY| PYY,Peptide tyrosine tyrosine polyclonal antibody
- Purification
- Whole rabbit serum.
- Immunogène
- Natural pig PYY (peptide with tyrosine, HYPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2.).
- Top Product
- Discover our top product PYY Anticorps primaire
-
-
- Indications d'application
- Western Blot (1:1,000, ECL)Suggested dilutions/conditions may not be available for all applications.Optimal conditions must be determined individually for each application.
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Buffer
- Liquid. Antiserum containing 10 mM sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid freeze/thaw cycles.
- Stock
- -20 °C
-
- Antigène
- Peptide YY (PYY)
- Autre désignation
- Peptide tyrosine tyrosine (PYY Produits)
- Synonymes
- anticorps PYY-I, anticorps PYY1, anticorps GHYY, anticorps RATGHYY, anticorps Yy, anticorps peptide-YY, anticorps peptide YY, anticorps peptide YY (mapped), anticorps PYY, anticorps Pyy
- UniProt
- P68005
-