PPP1R8 anticorps
-
- Antigène Voir toutes PPP1R8 Anticorps
- PPP1R8 (Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8))
-
Reactivité
- Archaeoprepona
-
Hôte
- Chèvre
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PPP1R8 est non-conjugé
-
Application
- Western Blotting (WB)
- Réactivité croisée (Details)
- Archeoprepona genus
- Purification
- Epitope affinity purified
- Immunogène
- Purified recombinant defensin ARD1 (MDKLIGSCVWGAVNYTSNCRAECKRRGYKGGHCGSFANVNCWCET) produced in E. coli
- Isotype
- IgG
- Top Product
- Discover our top product PPP1R8 Anticorps primaire
-
-
- Indications d'application
- WB:1:500-1:2,000
- Commentaires
-
Using the recombinant ARD1 gives a positive signal by Western blot. Due to high homology it is likely to recognise heliomycin
- Restrictions
- For Research Use only
-
- Concentration
- 2 mg/mL
- Buffer
- PBS, 20 % glycerol and 0.05 % sodium azide
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Stock
- 4 °C,-20 °C
- Stockage commentaire
- Store at -20 °C for long-term storage. Store at 2-8 °C for up to one month.
-
- Antigène
- PPP1R8 (Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8))
- Autre désignation
- ARD1 (PPP1R8 Produits)
-