PPP1R8 anticorps
-
- Antigène Voir toutes PPP1R8 Anticorps
- PPP1R8 (Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8))
-
Reactivité
- Archaeoprepona
-
Hôte
- Chèvre
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PPP1R8 est non-conjugé
-
Application
- Western Blotting (WB)
- Réactivité croisée (Details)
- Archeoprepona genus
- Purification
- Epitope affinity purified
- Immunogène
- Purified recombinant defensin ARD1 (MDKLIGSCVWGAVNYTSNCRAECKRRGYKGGHCGSFANVNCWCET) produced in E. coli
- Isotype
- IgG
- Top Product
- Discover our top product PPP1R8 Anticorps primaire
-
anti-Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8) (AA 1-209) antibody
PPP1R8 Reactivité: Humain WB, ELISA, IF Hôte: Souris Monoclonal 1G11 unconjugated
anti-Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8) (AA 1-209) antibodyPPP1R8 Reactivité: Humain WB, ELISA, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8) (AA 28-127) antibodyPPP1R8 Reactivité: Humain WB, ELISA, IP Hôte: Souris Monoclonal 4B5 unconjugated
anti-Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8) (C-Term) antibodyVerified PPP1R8 Reactivité: Humain, Souris WB, ELISA, IHC Hôte: Chèvre Polyclonal unconjugated
anti-Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8) (AA 21-120) antibodyPPP1R8 Reactivité: Souris, Poisson zèbre (Danio rerio) WB, ELISA, IF (cc), IF (p), IHC (p), IHC (fro) Hôte: Lapin Polyclonal unconjugated
anti-Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8) (AA 71-120) antibodyPPP1R8 Reactivité: Humain, Souris, Rat, Boeuf (Vache), Chien, Cheval, Lapin, Cobaye, Singe, Porc, Roussette (Chauve-souris), Hamster, Xenopus laevis, Poulet WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8) antibodyPPP1R8 Reactivité: Humain, Souris, Rat, Chien WB, IHC Hôte: Lapin Polyclonal unconjugated
anti-Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8) (N-Term) antibodyPPP1R8 Reactivité: Humain, Souris, Rat, Poisson zèbre (Danio rerio), Boeuf (Vache), Chien, Cheval, Lapin, Cobaye WB, IHC Hôte: Lapin Polyclonal unconjugated
anti-Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8) (Internal Region) antibodyPPP1R8 Reactivité: Humain, Souris, Rat WB, ELISA, IHC, IF, ICC Hôte: Lapin Polyclonal unconjugated
anti-Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8) (AA 91-140) antibodyPPP1R8 Reactivité: Humain, Souris, Rat, Boeuf (Vache), Chien, Cheval, Lapin, Cobaye, Singe, Porc, Roussette (Chauve-souris), Hamster, Xenopus laevis WB Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
- WB:1:500-1:2,000
- Commentaires
-
Using the recombinant ARD1 gives a positive signal by Western blot. Due to high homology it is likely to recognise heliomycin
- Restrictions
- For Research Use only
-
- Concentration
- 2 mg/mL
- Buffer
- PBS, 20 % glycerol and 0.05 % sodium azide
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Stock
- 4 °C,-20 °C
- Stockage commentaire
- Store at -20 °C for long-term storage. Store at 2-8 °C for up to one month.
-
- Antigène
- PPP1R8 (Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8))
- Autre désignation
- ARD1 (PPP1R8 Produits)
- Synonymes
- anticorps ARD-1, anticorps ARD1, anticorps NIPP-1, anticorps NIPP1, anticorps PRO2047, anticorps 6330548N22Rik, anticorps AU044684, anticorps PPP1R8, anticorps ard-1, anticorps ard1, anticorps nipp-1, anticorps nipp1, anticorps ppp1r8, anticorps si:ch211-206a7.1, anticorps protein phosphatase 1 regulatory subunit 8, anticorps protein phosphatase 1, regulatory subunit 8, anticorps protein phosphatase 1, regulatory (inhibitor) subunit 8, anticorps protein phosphatase 1, regulatory subunit 8b, anticorps protein phosphatase 1 regulatory subunit 8 L homeolog, anticorps protein phosphatase 1, regulatory subunit 8a, anticorps protein phosphatase 1 regulatory subunit 8 S homeolog, anticorps PPP1R8, anticorps Ppp1r8, anticorps ppp1r8b, anticorps ppp1r8.L, anticorps ppp1r8a, anticorps ppp1r8.S
-
