Tissue factor anticorps (AA 45-154)
-
- Antigène Voir toutes Tissue factor (F3) Anticorps
- Tissue factor (F3) (Coagulation Factor III (thromboplastin, Tissue Factor) (F3))
-
Épitope
- AA 45-154
-
Reactivité
- Humain
-
Hôte
- Souris
-
Clonalité
- Monoclonal
-
Conjugué
- Cet anticorp Tissue factor est non-conjugé
-
Application
- Western Blotting (WB), ELISA
- Fonction
- Mouse monoclonal antibody raised against a partial recombinant F3.
- Réactivité croisée
- Humain
- Immunogène
-
immunogen: F3 (AAH11029, 45 a.a. ~ 154 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen Sequence: TWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTK
- Clone
- 4G4
- Isotype
- IgG2a kappa
- Top Product
- Discover our top product F3 Anticorps primaire
-
-
- Indications d'application
- Optimal working dilution should be determined by the investigator.
- Commentaires
-
Product Quality tested by: Antibody Reactive Against Recombinant Protein.
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Buffer
- In ascites fluid
- Conseil sur la manipulation
- Aliquot to avoid repeated freezing and thawing.
- Stock
- -20 °C
- Stockage commentaire
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
-
Enhanced tissue factor expression by blood eosinophils from patients with hypereosinophilia: a possible link with thrombosis." dans: PLoS ONE, Vol. 9, Issue 11, pp. e111862, (2014) (PubMed).
: "
-
Enhanced tissue factor expression by blood eosinophils from patients with hypereosinophilia: a possible link with thrombosis." dans: PLoS ONE, Vol. 9, Issue 11, pp. e111862, (2014) (PubMed).
-
- Antigène
- Tissue factor (F3) (Coagulation Factor III (thromboplastin, Tissue Factor) (F3))
- Autre désignation
- F3 (F3 Produits)
- Synonymes
- anticorps CD142, anticorps TF, anticorps TFA, anticorps PRO1557, anticorps PRO2086, anticorps TFQTL1, anticorps f3, anticorps AA409063, anticorps Cf-3, anticorps Cf3, anticorps tf, anticorps zgc:112151, anticorps coagulation factor III, tissue factor, anticorps transferrin, anticorps coagulation factor IIIa, anticorps coagulation factor III, anticorps tissue factor, anticorps coagulation factor IIIb, anticorps coagulation factor III (thromboplastin, tissue factor) S homeolog, anticorps F3, anticorps TF, anticorps f3a, anticorps tf, anticorps f3b, anticorps f3.S
- Sujet
-
Full Gene Name: coagulation factor III (thromboplastin, tissue factor)
Synonyms: CD142,TF,TFA - ID gène
- 2152
- Pathways
- Positive Regulation of Endopeptidase Activity, Smooth Muscle Cell Migration, Platelet-derived growth Factor Receptor Signaling
-