ITGA3 anticorps (Cytoplasmic Domain)
-
- Antigène Voir toutes ITGA3 Anticorps
- ITGA3 (Integrin, alpha 3 (ITGA3))
-
Épitope
- Cytoplasmic Domain
-
Reactivité
- Humain
-
Hôte
- Souris
-
Clonalité
- Monoclonal
-
Conjugué
- Cet anticorp ITGA3 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC), Immunohistochemistry (Frozen Sections) (IHC (fro)), Immunocytochemistry (ICC)
- Specificité
- Reacts exclusively with the cytoplasmic domain of non-phosphorylated integrin subunit alpha-3A. A broad species reactivity is expected because of the conserved nature of the epitope.
- Purification
- Purified
- Immunogène
- Peptide corresponding to the cytoplasmic domain of the integrin subunit alpha-3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin
- Clone
- 158A3
- Isotype
- IgG2a
- Top Product
- Discover our top product ITGA3 Anticorps primaire
-
anti-Integrin, alpha 3 (ITGA3) (AA 33-236) antibody
ITGA3 Reactivité: Souris WB, IHC, IP, ICC Hôte: Lapin Polyclonal unconjugated
anti-Integrin, alpha 3 (ITGA3) (AA 63-248) antibodyITGA3 Reactivité: Humain WB, ELISA, FACS Hôte: Souris Monoclonal 5F1D4 unconjugated
anti-Integrin, alpha 3 (ITGA3) (AA 63-248) antibodyITGA3 Reactivité: Humain ELISA, FACS Hôte: Souris Monoclonal 7H2A11 unconjugated
anti-Integrin, alpha 3 (ITGA3) (AA 51-67), (N-Term) antibodyITGA3 Reactivité: Humain, Rat WB, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Integrin, alpha 3 (ITGA3) (N-Term) antibodyITGA3 Reactivité: Humain, Souris, Rat WB, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Integrin, alpha 3 (ITGA3) (AA 976-1025) antibodyITGA3 Reactivité: Souris, Porc WB, ELISA, FACS, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Integrin, alpha 3 (ITGA3) antibodyITGA3 Reactivité: Humain, Souris WB, ELISA, ICC, IF Hôte: Lapin Polyclonal unconjugated
anti-Integrin, alpha 3 (ITGA3) (AA 168-276) antibodyITGA3 Reactivité: Humain ELISA, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-Integrin, alpha 3 (ITGA3) (Internal Region) antibodyITGA3 Reactivité: Humain, Souris, Rat WB, ELISA Hôte: Lapin Polyclonal unconjugated
anti-Integrin, alpha 3 (ITGA3) (AA 165-199), (N-Term) antibodyITGA3 Reactivité: Humain WB Hôte: Lapin Polyclonal RB52792 unconjugated
-
- Indications d'application
-
Approved: ICC, IHC, IHC-Fr (1:100 - 1:200), WB (1:100 - 1:1000)
Not recommended for: IHC-P - Commentaires
-
Target Species of Antibody: Human
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Concentration
- Lot specific
- Buffer
- PBS containing 0.09 % sodium azide
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- avoid freeze thaw cycles. Store undiluted.
- Stock
- 4 °C,-20 °C
- Stockage commentaire
- Short term 4°C, long term aliquot and store at -20°C, avoid freeze-thaw cycles. Store undiluted.
-
- Antigène
- ITGA3 (Integrin, alpha 3 (ITGA3))
- Autre désignation
- ITGA3 / CD49c (ITGA3 Produits)
- Sujet
-
Name/Gene ID: ITGA3
Family: Integrin
Synonyms: ITGA3, Alpha3 integrin, CD49c antigen, CD49C, GAPB3, Integrin alpha-3, FRP-2, VCA-2, VLA-3 subunit alpha, VL3A, VLA3a, Galactoprotein B3, GAP-B3, ILNEB, Integrin alpha3, MSK18 - ID gène
- 3675
- UniProt
- P26006
- Pathways
- CXCR4-mediated Signaling Events, Integrin Complex
-
