ITGA3 anticorps (Cytoplasmic Domain)

N° du produit ABIN959436

Détail du produit anti-ITGA3 anticorps

Antigène: ITGA3 (Integrin, alpha 3 (ITGA3))

Épitope: Cytoplasmic Domain

Reactivité: Humain

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp ITGA3 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunocytochemistry (ICC), Immunohistochemistry (Frozen Sections) (IHC (fro))

Specificité: Recognizes specifically the cytoplasmic domain of integrin subunit alpha-3A which is present in the basal cell layer in skin, glomeruli, Bowman's capsules and distal tubuli in kidney, all vascular and capillary endothelia in brain, heart and skin, and vascular smooth muscle cells in heart. A broad species reactivity is expected because of the conserved nature of the epitope.

Purification: Purified

Immunogène: Synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha-3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin

Type of Immunogen: Synthetic peptide

Clone: 29A3

Isotype: IgG1

Information d'application

Indications d'application: Approved: ICC, IHC, IHC-Fr (1:100 - 1:200), WB (1:100 - 1:1000)

Not recommended for: IHC-P

Commentaires:

Target Species of Antibody: Human

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: Lot specific

Buffer: PBS containing 0.09 % sodium azide

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: avoid freeze thaw cycles. Store undiluted.

Stock: 4 °C,-20 °C

Stockage commentaire: Short term 4°C, long term aliquot and store at -20°C, avoid freeze-thaw cycles. Store undiluted.

Détails sur ITGA3

Antigène: ITGA3 (Integrin, alpha 3 (ITGA3))

Autre désignation: ITGA3 / CD49c (ITGA3 Produits)

Synonymes: anticorps CD49C, anticorps GAP-B3, anticorps GAPB3, anticorps ILNEB, anticorps MSK18, anticorps VCA-2, anticorps VL3A, anticorps VLA3a, anticorps ITGA3, anticorps AA407068, anticorps integrin subunit alpha 3, anticorps integrin subunit alpha 3 S homeolog, anticorps integrin alpha 3, anticorps ITGA3, anticorps itga3.S, anticorps Itga3

Sujet: Name/Gene ID: ITGA3
Family: Integrin

Synonyms: ITGA3, Alpha3 integrin, CD49c antigen, CD49C, GAPB3, Integrin alpha-3, FRP-2, VCA-2, VLA-3 subunit alpha, VL3A, VLA3a, Galactoprotein B3, GAP-B3, ILNEB, Integrin alpha3, MSK18

ID gène: 3675

UniProt: P26006

Pathways: CXCR4-mediated Signaling Events, Integrin Complex