VAPB Protein (AA 1-222) (His tag)

N° du produit ABIN667277

Détail du produit

Antigène: VAPB (VAMP (Vesicle-Associated Membrane Protein)-Associated Protein B and C (VAPB))

Type de proteíne: Recombinant

Attributs du protein: AA 1-222

Origine: Humain

Source: Escherichia coli (E. coli)

Purification/Conjugué: Cette VAPB protéine est marqué à la His tag.

Application: SDS-PAGE (SDS)

Séquence: MGSSHHHHHHSSGLVPRGSHMAKVEQVLSLEPQHELKFRG PFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGI IDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTS DMEAVWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINKI ISTTASKTETPIVSKSLSSSLDDTEVKKVMEECKRLQGEV QRLREENKQFKEEDGLRMRKTVQSNSPISALAPTGKEEGL ST

Attributs du produit: VAPB, 1-222aa, Human, His tag, E.coli

Pureté: > 90 % by SDS - PAGE

Information d'application

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: 1.0 mg/ml (determined by Bradford assay)

Buffer: Liquid. 20mM Tris-HCl buffer (pH8.0) containing 10% glycerol

Stock: 4 °C

Détail du antigène

Antigène: VAPB (VAMP (Vesicle-Associated Membrane Protein)-Associated Protein B and C (VAPB))

Autre désignation: VAPB (VAPB Produits)

Synonymes: ALS8 Protein, VAMP-B Protein, VAP-B Protein, AI225786 Protein, AI840687 Protein, AI848259 Protein, D2Abb2e Protein, R75548 Protein, VAP33b Protein, Vamp33b Protein, fc05d09 Protein, wu:fa96d05 Protein, wu:fc05d09 Protein, zgc:66045 Protein, vamp-b Protein, vamp-c Protein, vap-b Protein, vap-c Protein, vapb Protein, VAMP associated protein B and C Protein, vesicle-associated membrane protein-associated protein B/C Protein, vesicle-associated membrane protein, associated protein B and C Protein, VAMP (vesicle-associated membrane protein)-associated protein B and C Protein, VAMP (vesicle-associated membrane protein)-associated protein B and C L homeolog Protein, VAPB Protein, Tsp_07972 Protein, Vapb Protein, vapb Protein, vapb.L Protein

Sujet: VAPB, also known as vesicle-associated membrane protein (VAMP)-associated protein B, is a type IV transmembrane protein and member of the VAP family of proteins. This protein may play a role in vesicle trafficking. It is found in plasma and intracellular vesicle membranes as a homodimer and heterodimer with VAPA, and interacts with VAMP1 and VAMP2. Defects in VAPB are a cause of amyotrophic lateral sclerosis type 8 and spinal muscular atrophy autosomal dominant Finkel type. Recombinant human VAPB protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography. Synonyms: Vesicle-associated membrane protein-associated protein B/C, ALS8, VAMP-B, VAMP-C, VAP-B, VAP-C. NCBI no.: NP_004729

Poids moléculaire: 27.1 kDa (242aa) confirmed by MALDI-TOF (molecular weight on SDS-PAGE will appear higher)

Pathways: ER-Nucleus Signaling