GFP Protein (AA 1-238) (His tag)
-
- Antigène Voir toutes GFP Protéines
- GFP (Green Fluorescent Protein (GFP))
- Type de proteíne
- Recombinant
- Attributs du protein
- AA 1-238
-
Origine
- Différentes espèces
-
Source
- Escherichia coli (E. coli)
- Purification/Conjugué
- Cette GFP protéine est marqué à la His tag.
- Application
- SDS-PAGE (SDS), Western Blotting (WB), Positive Control (PC), Immunogen (Imm)
- Séquence
- S-Met1-Lys238-TRTRPLEQKL ISEEDLAAND ILDYKDDDDK V
- Attributs du produit
- Recombinant Green Fluorescent Protein (GFP), Prokaryotic expression, S-Met1-Lys238myc-FLAG tag, N-terminal His Tag
- Pureté
- > 90 %
- Top Product
- Discover our top product GFP Protéine
-
-
- Indications d'application
- Optimal working dilution should be determined by the investigator.
- Commentaires
-
Isoelectric Point:5.1
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Buffer
- PBS, pH7.4, containing 20% Glycerine
- Stock
- 4 °C,-80 °C
- Stockage commentaire
- Store at 2-8°C for one month. Aliquot and store at -80°C for 12 months.
- Date de péremption
- 12 months
-
- Antigène
- GFP (Green Fluorescent Protein (GFP))
- Autre désignation
- Green Fluorescent Protein (GFP Produits)
- Synonymes
- green fluorescent protein Protein, gfp Protein
- Classe de substances
- Viral Protein
- Poids moléculaire
- 37kDa
-